Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbD (pcbD)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbD (pcbD) spans the amino acid sequence from region 1-370.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbD

UniProt

Q46JW9

Expression Region

1-370

Origin

Prochlorococcus marinus (strain NATL2A)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQSYGNPDVTYEWWAGNSVVTSRSGRFIASHIGHTGLIAFAAGGSTLWELARYNPEIPMG HQSSLFLGHLAAFGVGFDEAGAWTGVGVAAVAIVHLVLSMVYGGGALLHAVYFEADVADS EVPRARKFKLEWNNPDNQTFILGHHLFFFGMACIAFVEWARIHGIYDPAIGSVRQVNYNL DLTMIWNRQFDFIGIDSLEDVMGGHAFLAFAELTGATIHMVAGSTQWENKRLGEWSKYKG AELLSAEAVLSWSLAGIGWMAIVAAFWAATNTTVYPIEWFGEPLKLQFSVAPYWIDTADS TGITAFFGHTTRAALVNVHYYFGFFFLQGHFWHALRALGFDFKKVSEAIGNTEGATVRVE GAGFNGRAPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Linoleic Acid-d11
TRC-L467497-250MG 250 mg

Linoleic Acid-d11

Sign In for Pricing
View Details
HIST1H2BC (Ab-12) Antibody
CSB-PA010403OA12nacHU-01 50 μL

HIST1H2BC (Ab-12) Antibody

Sign In for Pricing
View Details
HIST1H2BC (Ab-12) Antibody
CSB-PA010403OA12nacHU-02 100 µL

HIST1H2BC (Ab-12) Antibody

Sign In for Pricing
View Details
Goat anti Rat IgG (H + L) (Fab'2) (FITC)
MBS538847-01 0.5 mg

Goat anti Rat IgG (H + L) (Fab'2) (FITC)

Sign In for Pricing
View Details
Goat anti Rat IgG (H + L) (Fab'2) (FITC)
MBS538847-02 5x 0.5 mg

Goat anti Rat IgG (H + L) (Fab'2) (FITC)

Sign In for Pricing
View Details
FUBP1 (far Upstream Element (FUSE) Binding Protein 1, FBP, FUBP) (MaxLight 490)
246391-ML490 100 µL

FUBP1 (far Upstream Element (FUSE) Binding Protein 1, FBP, FUBP) (MaxLight 490)

Sign In for Pricing
View Details