Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RING finger and transmembrane domain-containing protein 1 (Rnft1)

This Recombinant Mouse RING finger and transmembrane domain-containing protein 1 (Rnft1) spans the amino acid sequence from region 1-395.

Product Specifications

Product Name Alternative

RING finger and transmembrane domain-containing protein 1

UniProt

Q9DCN7

Expression Region

1-395

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQASCNQLHDPPGTAHEDAAASPCGHSRSTEGSLHPGDVHIQINSGPKEYSENPSSRNPR SGVCTCAHGCVHGRFRSYSHSEARPPDDFATESGEHGSGSFSEFRYLFKWLQKSLPYILI LGIKLVMQHITGISLGIGLLTTFMYANKSIVNQVFLRERSSKLRCAWLLVFLAGSSVLLY YTFHSQSLHYSLIFLNPTLEQLSFWEVLWIVGITDFILKFFFMGLKCLILLVPSFIMPFK SKGYWYMLLEELCQYYRIFVPIPVWFRYLISYGEFGNVTTWSLGILLALLYLILKLLDFF GHLRTFRQVLRVFFTRPSYGVPASKRQCSDMDGICTICQAEFQKPVLLFCQHIFCEECIT LWFNREKTCPLCRTVISECINKWKDGATSSHLQMY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEAD2 Antibody
8C11087-AAT 50 µg

TEAD2 Antibody

Sign In for Pricing
View Details
IGFBP7 (NM_001553) Human Over-expression Lysate
LC419862 20 µg

IGFBP7 (NM_001553) Human Over-expression Lysate

Sign In for Pricing
View Details
Tyrosine Hydroxylase Rabbit Polyclonal Antibody
R1706-18 100 µL

Tyrosine Hydroxylase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calcitonin Recombinant Rabbit Monoclonal Antibody [PD00-46]
HA721181 100 µL

Calcitonin Recombinant Rabbit Monoclonal Antibody [PD00-46]

Sign In for Pricing
View Details
Human IGLL1 activation kit by CRISPRa
GA102366 1 Kit

Human IGLL1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Dmac2 activation kit by CRISPRa
GA206721 1 Kit

Mouse Dmac2 activation kit by CRISPRa

Sign In for Pricing
View Details