Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative membrane protein ycf1 (ycf1)

This Recombinant Putative membrane protein ycf1 (ycf1) spans the amino acid sequence from region 1-410.

Product Specifications

Product Name Alternative

Putative membrane protein ycf1, RF1

UniProt

Q9MUM0

Expression Region

1-410

Origin

Mesostigma viride

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYLISSLPFPNNFLNSSHSPFVFGLICGSLLGTSMNVGSFISLRRLIIQGIPAGVVSYL GSAISETFFLFLILFGYIGVIEKWFTLEPSLTFIITVFCADTIIGFLLDNRLKIVSLSQT TDLLKIFLCNAVIVFGNPGSTWGATSLITSIEGFQFRENSLFLFGVFLGIFVIGCGIGFL ILALTNLWMIQSSKTFRSLIYRSNKIISHLALCILILSTIYYHWQVYIGLSLSTSSMPMI TITKHDREPFYTDDESQMSWNRYKNKVERKNQPHPMKTLGGLPIKQFGQWFKKNVITSNP EDLDARGLPRERTKTGDYVPNYETMQAIRNKKWFSRSKNYLYIKEKIFSLLSINPMKVKF LEHSRRDMDLFYLGDKKSTRITITEMSKSDYNQMLENRKQRIQNIINRRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD38 Protein, Rat, Recombinant (hFc)
TMPY-03087-01 5 µg

CD38 Protein, Rat, Recombinant (hFc)

Sign In for Pricing
View Details
CD38 Protein, Rat, Recombinant (hFc)
TMPY-03087-02 10 µg

CD38 Protein, Rat, Recombinant (hFc)

Sign In for Pricing
View Details
CD38 Protein, Rat, Recombinant (hFc)
TMPY-03087-03 20 µg

CD38 Protein, Rat, Recombinant (hFc)

Sign In for Pricing
View Details
CD38 Protein, Rat, Recombinant (hFc)
TMPY-03087-04 50 µg

CD38 Protein, Rat, Recombinant (hFc)

Sign In for Pricing
View Details
MARCH7 Antibody - N-terminal region
ARP43306_P050-25UL 25 µL

MARCH7 Antibody - N-terminal region

Sign In for Pricing
View Details
PNPLA2 Polyclonal Antibody
A72751-050 50 µL

PNPLA2 Polyclonal Antibody

Sign In for Pricing
View Details