Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Calcium-binding mitochondrial carrier protein SCaMC-2-B (slc25a25b)

This Recombinant Danio rerio Calcium-binding mitochondrial carrier protein SCaMC-2-B (slc25a25b) spans the amino acid sequence from region 1-469.

Product Specifications

Product Name Alternative

Calcium-binding mitochondrial carrier protein SCaMC-2-B, Small calcium-binding mitochondrial carrier protein 2-B, Solute carrier family 25 member 25-B

UniProt

A2CEQ0

Expression Region

1-469

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLCLCLYVPVHISERTEFEYFESESLPVQLKSLFKLSLFLPSQEFDSYRKWRKKVVKAGD KDLDGQLDFEEFVHYLRDHEKKLRLVFKSLDKKNDGHIDSQEIMQSLRDLGVHISEEQAE KILKSMDKNGTMTIDWNEWRDYHLLHPAENIPEIILYWKHSTIFDVGESMLVPDEFTAEE KNTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHATRSNSMGIAGGFTQMIREGGLR SLWRGNGINVLKIAPESAIKFMAYEQIKRLIGSNQETLGILERLVSGSLAGAIAQSSIYP MEVLKTRLALGRTGQYSGIADCAKHIFKKEGMTAFYKGYIPNMLGIIPYAGIDLAVYETL KNSWLQRFATDSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQASQEGSPQMTMS GLFRHIVRTEGAIGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
BNC680009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-500 1x 500 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (Leucocyte Marker) (PTPRC/1147 + PTPRC/1460), CF740 conjugate, 0.1mg/mL
BNC742027-100 1x 100 µL

CD45 / LCA (Leucocyte Marker) (PTPRC/1147 + PTPRC/1460), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DC10), CF405S conjugate, 0.1mg/mL
BNC040021-100 1x 100 µL

Cytokeratin 18 (DC10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details