Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Metalloreductase STEAP4 (Steap4)

This Recombinant Rat Metalloreductase STEAP4 (Steap4) spans the amino acid sequence from region 1-470.

Product Specifications

Product Name Alternative

Metalloreductase STEAP4, EC= 1.16.1.-, Six-transmembrane epithelial antigen of prostate 4

UniProt

Q4V8K1

Expression Region

1-470

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKTCADEFPLTVDSSEKQGVVCIFGTGDFGKSLGLKMLQCGYSVVFGSRNPQVSSLLPR GAEVLCYSEAASRSDVIVLAVHREHYDFLAELADSLKGRVLIDVSNNQKMNQYPESNAEY LAQLVPGAHVVKAFNTISAWALQSGTLDASRQVFVCGNDSKAKDRVMDIARTLGLTPLDQ GSLVAAKEIENYPLQLFPMWRFPFYLSSGLCVFFFVYCAIREVIYPYVTGKTDSTYRLVV SIPNRVFPITALTLLALVYLPGILAAILQLYRGTKYRRFPNWLDHWMLCRKQLGLVALGF AFLHAIYTLVIPIRYYVRWRLRNATITQALTNKDSPFSSSTAWLSDSYLALGILGFFLFL LLGITSLPSVSNMVNWREFRFVQSKLGYLTLVLCTAHTLVYGGKRFLSPSILIWSLPSAY ILALIIPCTVLVMKFILIMPCIDKTLTRIRQGWERKSKYAQSTLNGKSDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-500 1x 500 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), Biotin conjugate, 0.1mg/mL
BNCB0333-500 1x 500 µL

CD8 (RIV11), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Golgi Complex (Marker for Human Cells) (GLG1/2829R), CF568 conjugate, 0.1mg/mL
BNC682829-500 1x 500 µL

Golgi Complex (Marker for Human Cells) (GLG1/2829R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (BP53-12 + DO-7), CF405S conjugate, 0.1mg/mL
BNC040723-100 1x 100 µL

P53 (BP53-12 + DO-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details