Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Sensor protein pilS (pilS)

This Recombinant Pseudomonas aeruginosa Sensor protein pilS (pilS) spans the amino acid sequence from region 1-530.

Product Specifications

Product Name Alternative

Sensor protein pilS, EC= 2.7.13.3

UniProt

P33639

Expression Region

1-530

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRAERLRLSEEQGQRILRLYHLYRLTIGLVLVLLISSELEDQVLKLVHPELFHVGSWCYL VFNILVALFLPPSRQLLPIFILALTDVLMLCGLFYAGGGVPSGIGSLLVVAVAIANILLR GRIGLVIAAAASLGLLYLTFFLSLSSPDATNHYVQAGGLGTLCFAAALVIQALVRRQEQT ETLAEERAETVANLEELNALILQRMRTGILVVDSRQAILLANQAALGLLRQDDVQGASLG RHSPMLMHCMKQWRLNPSLRPPTLKVVPDGPTVQPSFISLNREDDQHVLIFLEDISQIAQ QAQQMKLAGLGRLTAGIAHEIRNPLGAISHAAQLLQESEELDAPDRRLTQIIQDQSKRMN LVIENVLQLSRRRQAEPQQLDLKEWLQRFVDEYPGRLRNDSQLHLQLGAGDIQTRMDPHQ LNQVLSNLVQNGLRYSAQAHGRGQVWLSLARDPESDLPVLEVIDDGPGVPADKLNNLFEP FFTTESKGTGLGLYLSRELCESNQARIDYRNREEGGGCFRITFAHPRKLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-APC Antibody, Affinity Purified
A300-979A 100 µg

Rabbit anti-APC Antibody, Affinity Purified

Sign In for Pricing
View Details
NR3C2 (Mineralocorticoid Receptor, MR, Nuclear Receptor Subfamily 3 Group C Member 2, MCR, MLR, FLJ41052, MGC133092, NR3C2VIT) (FITC)
MBS6401508-01 0.1 mL

NR3C2 (Mineralocorticoid Receptor, MR, Nuclear Receptor Subfamily 3 Group C Member 2, MCR, MLR, FLJ41052, MGC133092, NR3C2VIT) (FITC)

Sign In for Pricing
View Details
NR3C2 (Mineralocorticoid Receptor, MR, Nuclear Receptor Subfamily 3 Group C Member 2, MCR, MLR, FLJ41052, MGC133092, NR3C2VIT) (FITC)
MBS6401508-02 5x 0.1 mL

NR3C2 (Mineralocorticoid Receptor, MR, Nuclear Receptor Subfamily 3 Group C Member 2, MCR, MLR, FLJ41052, MGC133092, NR3C2VIT) (FITC)

Sign In for Pricing
View Details
Cytokeratin 10 (LH2) AC
sc-53252 AC 500 µg/mL - 25% ag

Cytokeratin 10 (LH2) AC

Sign In for Pricing
View Details
Goat anti-mouse IgG Rhodamine Antibody
MBS856867-01 0.1 mL

Goat anti-mouse IgG Rhodamine Antibody

Sign In for Pricing
View Details
Goat anti-mouse IgG Rhodamine Antibody
MBS856867-02 0.1 mL (AF405L)

Goat anti-mouse IgG Rhodamine Antibody

Sign In for Pricing
View Details