Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthomonas campestris pv. campestris Membrane protein insertase YidC (yidC)

This Recombinant Xanthomonas campestris pv. campestris Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-573.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q8P338

Expression Region

1-573

Origin

Xanthomonas campestris pv. campestris (strain ATCC 33913 / NCPPB 528 / LMG 568)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQTRVFLIFAWLMVAALLWMEWGKDKAAANAPTPIASQAVPAARDPDAAAPAANVPSAQ AIPQAGSPAAVPATSTTTATPATTGAAPAITLTSDVLRLKLDGRSVLDAELLQFPQTKDG TEPVKLLTEDAAHPYNATSGWASERSPVPGVGGFRAEQPGTTFELAKGQNTLVVPFVWNG PNGVSIRRIFTLQRGSYAISIKDEVINKSDAAWNGYVFRKLSRVPTILSRGMTNPDSFSF NGATWYSPQEGYERRAFKDYMDDGGLNRQITGGWVALLQHHFFTAWIPQKDQASLYVLAQ DGPRDVAELRGPAFTVAPGQSASTEARLWVGPKLVSLLAKEDVKGLDRVVDYSRFSIMAI IGQGLFWVLSHLHSFLHNWGWAIIGLVVLLRLALYPLSAAQYKSGAKMRRFQPRLAQLKE RYGDDRQKYQQATMELFKKEKINPMGGCLPLLIQMPIFFALYWVLVESVELRQAPWLGWI QDLTARDPYFILPVLNIAIMWATQKLTPTPGMDPMQAKMMQFMPLVFGVMMAFMPAGLVL YWVVNGGLGLLIQWWMIRQHGEKPSKIIQANAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
BNC040226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
BNC681073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-100 1x 100 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF488A conjugate, 0.1mg/mL
BNC882145-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details