Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Sensor protein lytS (lytS)

This Recombinant Staphylococcus epidermidis Sensor protein lytS (lytS) spans the amino acid sequence from region 1-591.

Product Specifications

Product Name Alternative

Sensor protein lytS, EC= 2.7.13.3, Autolysin sensor kinase

UniProt

Q5HLG3

Expression Region

1-591

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNLFILLLERVGLIILLAYILMNINHFKTMMSERDKWRSKFQLIIIFGIFSMISNFTGI EIENGHIVSGDIYYHLSKDASMANTRVLTIGVSGLIGGPWVAIIVGIISGLCRLYIGGAD AYTYLISSIVIAIISGYFGHQTIKQNTYPSIKKGAIIGAITEIIQMGCILLFTNNLHHAI TLVSFIALPMIIINSLGTAIFLTIILSTIKQEEQMRAVQTHDVLQLANETLPYFRSGLNE KSAQQAAEIILKLMQVSAVAITNKKDILTHIGAGSDHHVARKEIITDLSKEVIQSGKLKV AHTREGIGCHHPNCPLEGAIVVPLYIHNEVAGTLKFYFTDNNIISTSDQQLAKGLANIFS SQLELGQAEMQGQLLKDAEIKSLQAQVNPHFFFNAINTISALVRIDSEKARRLLIQLSQF FRSNLNGARNNTITLQKELQQVAAYLSLEQARYPNRFNIHYRIDDQCQDALIPPFIIQIL VENSIKHAFKNRKKNNHIDVDVSMKQDYLSISVQDNGQGIPADQLDTIGYTTVTSTTGTG NALVNLNKRLTGLFGTTSALNIQSSQSGTTVSCLIPYKSSKEEHFNESVNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44/HCAM Std.(Cancer Stem Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone HCAM/6459R]
MBS4382408-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

CD44/HCAM Std.(Cancer Stem Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone HCAM/6459R]

Sign In for Pricing
View Details
CD44/HCAM Std.(Cancer Stem Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone HCAM/6459R]
MBS4382408-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

CD44/HCAM Std.(Cancer Stem Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone HCAM/6459R]

Sign In for Pricing
View Details
CD44/HCAM Std.(Cancer Stem Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone HCAM/6459R]
MBS4382408-03 0.1 mg (Without BSA & Azide at 1mg/mL)

CD44/HCAM Std.(Cancer Stem Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone HCAM/6459R]

Sign In for Pricing
View Details
CD44/HCAM Std.(Cancer Stem Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone HCAM/6459R]
MBS4382408-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

CD44/HCAM Std.(Cancer Stem Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone HCAM/6459R]

Sign In for Pricing
View Details
CD44/HCAM Std.(Cancer Stem Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone HCAM/6459R]
MBS4382408-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)

CD44/HCAM Std.(Cancer Stem Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone HCAM/6459R]

Sign In for Pricing
View Details
Mouse monoclonal MafB Antibody (OTI1E9)
NBP2-45718 0.1 mL

Mouse monoclonal MafB Antibody (OTI1E9)

Sign In for Pricing
View Details