Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Short-wave-sensitive opsin 1 (OPN1SW)

This Recombinant Human Short-wave-sensitive opsin 1 (OPN1SW) spans the amino acid sequence from region 265-348.

Product Specifications

Product Name Alternative

Short-wave-sensitive opsin 1, Blue cone photoreceptor pigment, Blue-sensitive opsin, BOP

UniProt

P03999

Expression Region

265-348

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SREBP2 Antibody (SREBP2/1579) [DyLight 405]
NBP3-08527V 100 µL

Mouse Monoclonal SREBP2 Antibody (SREBP2/1579) [DyLight 405]

Sign In for Pricing
View Details
Plant Ribonuclease L (RNASEL) ELISA Kit
MBS9379183 Inquire

Plant Ribonuclease L (RNASEL) ELISA Kit

Sign In for Pricing
View Details
ERAS Human Over-expression Lysate
orb1374913 20 µg

ERAS Human Over-expression Lysate

Sign In for Pricing
View Details
Yap1 Rat shRNA Plasmid (Locus ID 363014)
TR703271 1 Kit

Yap1 Rat shRNA Plasmid (Locus ID 363014)

Sign In for Pricing
View Details
Rabbit Polyclonal Contactin-1 Antibody
NBP2-98360-100ul 100 µL

Rabbit Polyclonal Contactin-1 Antibody

Sign In for Pricing
View Details
Cot inhibitor-1
BISN0292-01 1 mg

Cot inhibitor-1

Sign In for Pricing
View Details