Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Short-wave-sensitive opsin 1 (OPN1SW)

This Recombinant Human Short-wave-sensitive opsin 1 (OPN1SW) spans the amino acid sequence from region 265-348.

Product Specifications

Product Name Alternative

Short-wave-sensitive opsin 1, Blue cone photoreceptor pigment, Blue-sensitive opsin, BOP

UniProt

P03999

Expression Region

265-348

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JEV NS1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-41388R-BF405 100 µL

JEV NS1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
AlkaSept™ OPA In 5 lit can pack
CO162-1NO 1 unit

AlkaSept™ OPA In 5 lit can pack

Sign In for Pricing
View Details
Mouse Lipase, Endothelial (LIPG) ELISA Kit
DL-LIPG-Mu-01 48 Tests

Mouse Lipase, Endothelial (LIPG) ELISA Kit

Sign In for Pricing
View Details
Mouse Lipase, Endothelial (LIPG) ELISA Kit
DL-LIPG-Mu-02 96 Tests

Mouse Lipase, Endothelial (LIPG) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse Cytochrome b reductase 1 (Cybrd1)
orb2910759-01 20 µg

Recombinant Mouse Cytochrome b reductase 1 (Cybrd1)

Sign In for Pricing
View Details
Recombinant Mouse Cytochrome b reductase 1 (Cybrd1)
orb2910759-02 100 µg

Recombinant Mouse Cytochrome b reductase 1 (Cybrd1)

Sign In for Pricing
View Details