Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Short-wave-sensitive opsin 1 (OPN1SW)

This Recombinant Human Short-wave-sensitive opsin 1 (OPN1SW) spans the amino acid sequence from region 265-348.

Product Specifications

Product Name Alternative

Short-wave-sensitive opsin 1, Blue cone photoreceptor pigment, Blue-sensitive opsin, BOP

UniProt

P03999

Expression Region

265-348

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTGF/CCN2 Protein, Rhesus macaque, Recombinant (His)
TMPK-00672-01 5 µg

CTGF/CCN2 Protein, Rhesus macaque, Recombinant (His)

Sign In for Pricing
View Details
CTGF/CCN2 Protein, Rhesus macaque, Recombinant (His)
TMPK-00672-02 10 µg

CTGF/CCN2 Protein, Rhesus macaque, Recombinant (His)

Sign In for Pricing
View Details
CTGF/CCN2 Protein, Rhesus macaque, Recombinant (His)
TMPK-00672-03 20 µg

CTGF/CCN2 Protein, Rhesus macaque, Recombinant (His)

Sign In for Pricing
View Details
CTGF/CCN2 Protein, Rhesus macaque, Recombinant (His)
TMPK-00672-04 50 µg

CTGF/CCN2 Protein, Rhesus macaque, Recombinant (His)

Sign In for Pricing
View Details
CTGF/CCN2 Protein, Rhesus macaque, Recombinant (His)
TMPK-00672-05 100 µg

CTGF/CCN2 Protein, Rhesus macaque, Recombinant (His)

Sign In for Pricing
View Details
CTGF/CCN2 Protein, Rhesus macaque, Recombinant (His)
TMPK-00672-06 200 µg

CTGF/CCN2 Protein, Rhesus macaque, Recombinant (His)

Sign In for Pricing
View Details