Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lysoplasmalogenase (TMEM86B)

This Recombinant Human Lysoplasmalogenase (TMEM86B) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Lysoplasmalogenase, EC= 3.3.2.2, EC= 3.3.2.5, Transmembrane protein 86B

UniProt

Q8N661

Expression Region

1-226

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAGKAGQTLKTHCSAQRPDVCRWLSPFILSCCVYFCLWIPEDQLSWFAALVKCLPVLCL AGFLWVMSPSGGYTQLLQGALVCSAVGDACLIWPAAFVPGMAAFATAHLLYVWAFGFSPL QPGLLLLIILAPGPYLSLVLQHLEPDMVLPVAAYGLILMAMLWRGLAQGGSAGWGALLFT LSDGVLAWDTFAQPLPHAHLVIMTTYYAAQLLITLSALRSPVPKTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Cylindromatosis (CYLD)
TRV-0059492-01 20 µL

Monoclonal Antibody to Cylindromatosis (CYLD)

Sign In for Pricing
View Details
Monoclonal Antibody to Cylindromatosis (CYLD)
TRV-0059492-02 100 µL

Monoclonal Antibody to Cylindromatosis (CYLD)

Sign In for Pricing
View Details
Monoclonal Antibody to Cylindromatosis (CYLD)
TRV-0059492-03 200 µL

Monoclonal Antibody to Cylindromatosis (CYLD)

Sign In for Pricing
View Details
Monoclonal Antibody to Cylindromatosis (CYLD)
TRV-0059492-04 1 mL

Monoclonal Antibody to Cylindromatosis (CYLD)

Sign In for Pricing
View Details
Bovine Phosphatidylserine Decarboxylase (PSD) ELISA Kit
MBS109062-01 48 Well

Bovine Phosphatidylserine Decarboxylase (PSD) ELISA Kit

Sign In for Pricing
View Details
Bovine Phosphatidylserine Decarboxylase (PSD) ELISA Kit
MBS109062-02 96 Well

Bovine Phosphatidylserine Decarboxylase (PSD) ELISA Kit

Sign In for Pricing
View Details