Recombinant Arcobacter butzleri ATP synthase subunit a (atpB)
This Recombinant Arcobacter butzleri ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-228.
Product Specifications
Product Name Alternative
ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6
UniProt
A8EWC4
Expression Region
1-228
Origin
Arcobacter butzleri (strain RM4018)
Field of Research
Immunology & Inflammation; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEGRLFTFLGAIGGHGQEWIILSHYVLVIGIIFIIARAATRKLQLVPTGSQNVLEAFVGG IISMGADTMGEKNARTYMPLIGSLALVIFVSNMIGVIPGFEAPTSNINFTLSLALIVFVY YNYLGIKKNGFVAYFKHFMGPMPVLAPLMFPIEIISHLSRIVSLSFRLFGSIRGDDMFLM VLLMLVPWILPLPGFFLLTAFGVLQAFIFSILTYVYIAGSIMMEHEEH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680669-500 1x 500 µL
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471231-500 1x 500 µL
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 