Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Antiholin-like protein LrgB (lrgB)

This Recombinant Staphylococcus aureus Antiholin-like protein LrgB (lrgB) spans the amino acid sequence from region 1-233.

Product Specifications

Product Name Alternative

Antiholin-like protein LrgB

UniProt

Q2FK07

Expression Region

1-233

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINHLALNTPYFGILLSVIPFFLATILFEKTNRFFLFAPLFVSMVFGVAFLYLTGIPYKT YKIGGDIIYFFLEPATICFAIPLYKKREVLVKHWHRIIGGIGIGTVVALLIILTFAKLAQ FANDVILSMLPQAATTAIALPVSAGIGGIKELTSLAVILNGVIIYALGNKFLKLFRITNP IARGLALGTSGHTLGVAPAKELGPVEESMASIALVLVGVVVVAVVPVFVAIFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-100 1x 100 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10), CF740 conjugate, 0.1mg/mL
BNC740641-500 1x 500 µL

Chromogranin A (LK2H10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF568 conjugate, 0.1mg/mL
BNC681602-500 1x 500 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details