Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Type 4 prepilin-like proteins leader peptide-processing enzyme (comC)

This Recombinant Bacillus subtilis Type 4 prepilin-like proteins leader peptide-processing enzyme (comC) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Late competence protein ComC, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin p

UniProt

P15378

Expression Region

1-248

Origin

Bacillus subtilis (strain 168)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSILFIFGLILGSFYYTAGCRIPLHLSIIAPRSSCPFCRRTLTPAELIPILSFLFQKGK CKSCGHRISFMYPAAELVTACLFAAAGIRFGISLELFPAVVFISLLIIVAVTDIHFMLIP NRILIFFLPFLAAARLISPLDSWYAGLLGAAAGFLFLAVIAAITHGGVGGGDIKLFAVIG FVLGVKMLAAAFFFSVLIGALYGAAAVLTGRLAKRQPLPFAPAIAAGSILAYLYGDSIIS FYIKMALG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RFX3 Protein
E30P10155 20 µg

Recombinant Human RFX3 Protein

Sign In for Pricing
View Details
CDK5R1 Protein, Human, Recombinant (His)
TMPH-01170-01 5 µg

CDK5R1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
CDK5R1 Protein, Human, Recombinant (His)
TMPH-01170-02 10 µg

CDK5R1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
CDK5R1 Protein, Human, Recombinant (His)
TMPH-01170-03 20 µg

CDK5R1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
CDK5R1 Protein, Human, Recombinant (His)
TMPH-01170-04 50 µg

CDK5R1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
CDK5R1 Protein, Human, Recombinant (His)
TMPH-01170-05 100 µg

CDK5R1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details