Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Type 4 prepilin-like proteins leader peptide-processing enzyme (comC)

This Recombinant Bacillus subtilis Type 4 prepilin-like proteins leader peptide-processing enzyme (comC) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Late competence protein ComC, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin p

UniProt

P15378

Expression Region

1-248

Origin

Bacillus subtilis (strain 168)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSILFIFGLILGSFYYTAGCRIPLHLSIIAPRSSCPFCRRTLTPAELIPILSFLFQKGK CKSCGHRISFMYPAAELVTACLFAAAGIRFGISLELFPAVVFISLLIIVAVTDIHFMLIP NRILIFFLPFLAAARLISPLDSWYAGLLGAAAGFLFLAVIAAITHGGVGGGDIKLFAVIG FVLGVKMLAAAFFFSVLIGALYGAAAVLTGRLAKRQPLPFAPAIAAGSILAYLYGDSIIS FYIKMALG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish PSMD13 Rabbit Polyclonal Antibody (Carrier-free)
orb3089740 100 µg

Zebrafish PSMD13 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
IFN-beta (Interferon Beta) BioAssayTM ELISA Kit (Porcine) discontinued
356480-01 48 Tests

IFN-beta (Interferon Beta) BioAssayTM ELISA Kit (Porcine) discontinued

Sign In for Pricing
View Details
IFN-beta (Interferon Beta) BioAssayTM ELISA Kit (Porcine) discontinued
356480-02 96 Tests

IFN-beta (Interferon Beta) BioAssayTM ELISA Kit (Porcine) discontinued

Sign In for Pricing
View Details
Sds-Page Destain Solution
orb348549 1 L

Sds-Page Destain Solution

Sign In for Pricing
View Details
Recombinant human MINA protein
ATGP2802-020 20 µg

Recombinant human MINA protein

Sign In for Pricing
View Details
NLRP12, NT (NLRP12, NALP12, PYPAF7, RNO, NACHT, LRR and PYD domains-containing protein 12, Monarch-1, PYRIN-containing APAF1-like protein 7, Regulated by nitric oxide)
MBS642060-01 0.2 mL

NLRP12, NT (NLRP12, NALP12, PYPAF7, RNO, NACHT, LRR and PYD domains-containing protein 12, Monarch-1, PYRIN-containing APAF1-like protein 7, Regulated by nitric oxide)

Sign In for Pricing
View Details