Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalamin synthase (cobS)

This Recombinant Cobalamin synthase (cobS) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q897L5

Expression Region

1-252

Origin

Clostridium tetani

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYIYNFLLMIQFLTRIPVKRSLPCEKEDFRRGAAMLPLIGLIVGCIQWVVFYILSKIFP ANITAIFIILVGMVLIGGLHQDGLGDIFDGFFSFKGDKEKIIEIMKDSRVGTFAVLALIF DILIKYSALSFIIENNMSYAIIITPIMSRCTLVFLFLIGKNAKKNGTGNLFIENVSVKEF IISFIFMIVPSVLLIGYKYSVIIIVVSFIITLAFLNLCNRKIGGITGDCLGANNEIVEMF TMLVFVALLYIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M6-94-1-345-YL Pre-sized Sleeves for Printers
173546 100 Roll (100 Sleeve (s) x 1 Roll)

M6-94-1-345-YL Pre-sized Sleeves for Printers

Sign In for Pricing
View Details
ALDH18A1 (Delta-1-pyrroline-5-carboxylate Synthase, P5CS, Aldehyde Dehydrogenase Family 18 Member A1, GSAS, P5CS, PYCS, MGC117316) (Biotin)
123192-Biotin 100 µL

ALDH18A1 (Delta-1-pyrroline-5-carboxylate Synthase, P5CS, Aldehyde Dehydrogenase Family 18 Member A1, GSAS, P5CS, PYCS, MGC117316) (Biotin)

Sign In for Pricing
View Details
Human Low-Density Lipoprotein Receptor-Related Protein 1 (LRP1) Protein
abx067817-01 10 µg

Human Low-Density Lipoprotein Receptor-Related Protein 1 (LRP1) Protein

Sign In for Pricing
View Details
Human Low-Density Lipoprotein Receptor-Related Protein 1 (LRP1) Protein
abx067817-02 50 µg

Human Low-Density Lipoprotein Receptor-Related Protein 1 (LRP1) Protein

Sign In for Pricing
View Details
Human Low-Density Lipoprotein Receptor-Related Protein 1 (LRP1) Protein
abx067817-03 100 µg

Human Low-Density Lipoprotein Receptor-Related Protein 1 (LRP1) Protein

Sign In for Pricing
View Details
Human Low-Density Lipoprotein Receptor-Related Protein 1 (LRP1) Protein
abx067817-04 200 µg

Human Low-Density Lipoprotein Receptor-Related Protein 1 (LRP1) Protein

Sign In for Pricing
View Details