Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalamin synthase (cobS)

This Recombinant Cobalamin synthase (cobS) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q897L5

Expression Region

1-252

Origin

Clostridium tetani

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYIYNFLLMIQFLTRIPVKRSLPCEKEDFRRGAAMLPLIGLIVGCIQWVVFYILSKIFP ANITAIFIILVGMVLIGGLHQDGLGDIFDGFFSFKGDKEKIIEIMKDSRVGTFAVLALIF DILIKYSALSFIIENNMSYAIIITPIMSRCTLVFLFLIGKNAKKNGTGNLFIENVSVKEF IISFIFMIVPSVLLIGYKYSVIIIVVSFIITLAFLNLCNRKIGGITGDCLGANNEIVEMF TMLVFVALLYIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Azoarcus sp. Macrolide export ATP-binding/permease protein MacB (macB), partial
MBS7063385 Inquire

Recombinant Azoarcus sp. Macrolide export ATP-binding/permease protein MacB (macB), partial

Sign In for Pricing
View Details
P4ha3 sgRNA CRISPR Lentivector set (Mouse)
K4282001 3x 1.0 µg

P4ha3 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Rat Bradykinin Receptor B2 (BDKRB2) ELISA Kit
BSKR65639-01 48 Tests

Rat Bradykinin Receptor B2 (BDKRB2) ELISA Kit

Sign In for Pricing
View Details
Rat Bradykinin Receptor B2 (BDKRB2) ELISA Kit
BSKR65639-02 96 Tests

Rat Bradykinin Receptor B2 (BDKRB2) ELISA Kit

Sign In for Pricing
View Details
MMP8 Active Recombinant Protein Lyophilized 20ug
IHUMMP8ARTFLY20UG 20 µg

MMP8 Active Recombinant Protein Lyophilized 20ug

Sign In for Pricing
View Details
Pig Osteocalcin ELISA Kit
orb1675622 96 Tests

Pig Osteocalcin ELISA Kit

Sign In for Pricing
View Details