Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium salinarum Halorhodopsin (hop)

This Recombinant Halobacterium salinarum Halorhodopsin (hop) spans the amino acid sequence from region 22-274.

Product Specifications

Product Name Alternative

Halorhodopsin, HR

UniProt

P16102

Expression Region

22-274

Origin

Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVRENALLSSSLWVNVALAGIAILVFVYMGRTIRPGRPRLIWGATLMIPLVSISSYLGLL SGLTVGMIEMPAGHALAGEMVRSQWGRYLTWALSTPMILLALGLLADVDLGSLFTVIAAD IGMCVTGLAAAMTTSALLFRWAFYAISCAFFVVVLSALVTDWAASASSAGTAEIFDTLRV LTVVLWLGYPIVWAVGVEGLALVQSVGVTSWAYSVLDVFAKYVFAFILLRWVANNERTVA VAGQTLGTMSSDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-100 1x 100 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-500 1x 500 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF647 conjugate, 0.1mg/mL
BNC472981-500 1x 500 µL

Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF568 conjugate, 0.1mg/mL
BNC681865-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF488A conjugate, 0.1mg/mL
BNC881993-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details