Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae High-affinity zinc uptake system membrane protein znuB (znuB)

This Recombinant Haemophilus influenzae High-affinity zinc uptake system membrane protein znuB (znuB) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

High-affinity zinc uptake system membrane protein znuB

UniProt

P44691

Expression Region

1-261

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEILFPALLTGIVLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAI VVLTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLL AINYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTI ALSMKFVGALIITSLLIIPAATARRFARTPESMVGWAIIMSMLSIIGGLILSAFYDTAAG PSVVICSAFLFVLSLFKRERL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
BNC740676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-500 1x 500 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
BNC401820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin Receptor (B6.2 + PRLR742), CF640R conjugate, 0.1mg/mL
BNC400744-100 1x 100 µL

Prolactin Receptor (B6.2 + PRLR742), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/1148), CF740 conjugate, 0.1mg/mL
BNC741148-500 1x 500 µL

CD45RA (PTPRC/1148), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details