Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Parabacteroides distasonis Undecaprenyl-diphosphatase (uppP)

This Recombinant Parabacteroides distasonis Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A6LEL8

Expression Region

1-266

Origin

Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWFEALILGIVQGLTEYLPVSSSGHLAIGSALFGIEGEENLAFTIVVHVATVFSTLVVL WKEIDWIFRGLFKFQMNAETKYVINILISMIPIGIVGVFFKDTVEQIFGSGLLVVGCMLL LTAALLAFSYYAKPRQKESISMKDAFIIGLAQACAVMPGLSRSGSTIATGLLLGNNKAKL AQFSFLMVIPPILGEALLDVMKMVKGEDVAGDIPALSLAVGFMAAFVSGCVACKWMINIV KKGKLIYFAIYCAIAGLVTIACTLLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-100 1x 100 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-500 1x 500 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF770 conjugate, 0.1mg/mL
BNC700160-100 1x 100 µL

CD20 (B9E9), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-500 1x 500 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgM Immunoglobulin (IM260), CF640R conjugate, 0.1mg/mL
BNC400260-500 1x 500 µL

IgM Immunoglobulin (IM260), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details