Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrobacter winogradskyi Undecaprenyl-diphosphatase (uppP)

This Recombinant Nitrobacter winogradskyi Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q3SWA8

Expression Region

1-268

Origin

Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISDAIRAVILGIIEGVTEFLPVSSTGHLLLAERFFDLGSGNFWDTFTVLIQPGAILAIV VIYFAKLWRVALGMFSNPADRRFVIGVLAAFLPAVIVGLIAGKYIKELLFNPWVVCFSLI VGGAVLMWVDQLDHRPREHDATAFPLPMYVWIGIAQCVAMIPGVSRSGATIVSAMLLGAD KRAAAEFSFFLAIPTMTGAFAYDFYKNHADMTTDDLGTVAIGFVVSFVTAIIVVKAFLSY VTRNGFTFFAWWRVIVGTLGLIALALGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR205 Human qPCR Primer Pair (MI0000285)
HP300237 200 Reactions

MIR205 Human qPCR Primer Pair (MI0000285)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501025 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Creatine Phosphokinase-BB (CK-BB) (CPTC-CKB-2), 0.2mg/mL
BNUB2233-500 1x 500 µL

Creatine Phosphokinase-BB (CK-BB) (CPTC-CKB-2), 0.2mg/mL

Sign In for Pricing
View Details
Human LINGO2 activation kit by CRISPRa
GA115941 1 Kit

Human LINGO2 activation kit by CRISPRa

Sign In for Pricing
View Details
HCRT Polyclonal Antibody
E-AB-53517-01 20 µL

HCRT Polyclonal Antibody

Sign In for Pricing
View Details
HCRT Polyclonal Antibody
E-AB-53517-02 60 µL

HCRT Polyclonal Antibody

Sign In for Pricing
View Details