Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrobacter winogradskyi Undecaprenyl-diphosphatase (uppP)

This Recombinant Nitrobacter winogradskyi Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q3SWA8

Expression Region

1-268

Origin

Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISDAIRAVILGIIEGVTEFLPVSSTGHLLLAERFFDLGSGNFWDTFTVLIQPGAILAIV VIYFAKLWRVALGMFSNPADRRFVIGVLAAFLPAVIVGLIAGKYIKELLFNPWVVCFSLI VGGAVLMWVDQLDHRPREHDATAFPLPMYVWIGIAQCVAMIPGVSRSGATIVSAMLLGAD KRAAAEFSFFLAIPTMTGAFAYDFYKNHADMTTDDLGTVAIGFVVSFVTAIIVVKAFLSY VTRNGFTFFAWWRVIVGTLGLIALALGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis[2-(perfluorooctyl)ethyl] phosphate
TRC-B516320-25MG 25 mg

Bis[2-(perfluorooctyl)ethyl] phosphate

Sign In for Pricing
View Details
Smooth Muscle Actin (1A4), CF740 conjugate, 0.1mg/mL
BNC740665-500 1x 500 µL

Smooth Muscle Actin (1A4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS801179 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
Human RETREG1 activation kit by CRISPRa
GA110114 1 Kit

Human RETREG1 activation kit by CRISPRa

Sign In for Pricing
View Details
Ndufb4 (NM_026610) Mouse Tagged ORF Clone
MG200707 10 µg

Ndufb4 (NM_026610) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ReadiPrep™ Goat anti-rabbit IgG (H&L) Agarose
55015-AAT 10 mg

ReadiPrep™ Goat anti-rabbit IgG (H&L) Agarose

Sign In for Pricing
View Details