Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Pseudomonas fluorescens Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

C3K3Q9

Expression Region

1-270

Origin

Pseudomonas fluorescens (strain SBW25)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPYPQIDPVALAIGPLKIHWYGLMYLIGIGGAWFLASRRLNRFDPTWTKEKLSDLIFWL SMGVIVGGRLGYVLFYDLPAYIANPTLIFEVWKGGMAFHGGFIGVMIAAWWFGRRNGKSF FQLMDFVAPMVPIGLGAGRIGNFINAELWGKPTDVPWAMIFPPFSDPAQLPRHPSQLYQF ALEGVALFLILYIFSRKPRPTMAVSGMFALFYGIFRFVVEFVRVPDAQLGYLAFGWVTMG QILSLPMILGGLGLLWWAYNRPQPLKNTAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
BNC740806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-100 1x 100 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF488A conjugate, 0.1mg/mL
BNC882010-100 1x 100 µL

NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (C86/1146), CF740 conjugate, 0.1mg/mL
BNC741146-100 1x 100 µL

CD86 (C86/1146), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF568 conjugate, 0.1mg/mL
BNC680914-500 1x 500 µL

NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (TRP/817), CF740 conjugate, 0.1mg/mL
BNC740817-100 1x 100 µL

P53 (TRP/817), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details