Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. jejuni serotype O:6 Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Campylobacter jejuni subsp. jejuni serotype O:6 Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A8FKJ4

Expression Region

1-271

Origin

Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFWQHIYSNFNVIAFSIFGLKVHWYGIMYVIALLLALLLAKFFVRKFQLDINEKHLDSY FIWVEIGVILGARLGYILIYDANTMYYITHPWQIFNPYINGEFVGIRGMSYHGAIIGFLI ATLLFCKKYKTNPWIFLDLVALSVPLAYVFGRIGNFLNQELFGRITNVPWGIYVDGVLRH PSQLYEAFLEGIVVFIIVYLARFKQSFQGELILVYAGAYSLARFICEFYREPDFGIGFVL WGMSMGQILSFIMFITALLVYICIKFKKVNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF568 conjugate, 0.1mg/mL
BNC680176-500 1x 500 µL

CD5 (Cris-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF740 conjugate, 0.1mg/mL
BNC741035-500 1x 500 µL

CD8 (C8/1035), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-100 1x 100 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details