Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q1LTU8

Expression Region

1-273

Origin

Baumannia cicadellinicola subsp. Homalodisca coagulata

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKLVDNTTTRDYISHHLSHLQLNLNNFTLVNHPDIKSFWILNIDSIFFTLLLGIIFLLI FFYTAKTATSGIPSKLQTIVELLVSFIDKNVNDILFCKNKLIAPLALTIFIWIFLMNLMD LLAVDMLPYIAMYILHIPALRVVPSADINITLSLALGVFILIIYYNLKIKGITGFIKELT MQPFNHLIFIPLNFILESVSLLSKPISLALRLFGNIYAGELVFILIAGLLPWWSQWIISV PWALFHIIVITLQAFIFMVLTVVYIAMAYEQHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carebastine-d5
TRC-C183442-1MG 1 mg

Carebastine-d5

Sign In for Pricing
View Details
Human Sirtuin 5 (SIRT5) ELISA Kit
RDR-SIRT5-Hu-01 96 Tests

Human Sirtuin 5 (SIRT5) ELISA Kit

Sign In for Pricing
View Details
Human Sirtuin 5 (SIRT5) ELISA Kit
RDR-SIRT5-Hu-02 48 Tests

Human Sirtuin 5 (SIRT5) ELISA Kit

Sign In for Pricing
View Details
Cell Navigator® F-Actin Labeling Kit *Green Fluorescence*
22661-AAT 500 Tests

Cell Navigator® F-Actin Labeling Kit *Green Fluorescence*

Sign In for Pricing
View Details
Frozen Tissue Sections, Neurovascular bundle
CS627151 5x 5 µm

Frozen Tissue Sections, Neurovascular bundle

Sign In for Pricing
View Details
Uncoated Mouse CHEM (Chemerin) ELISA Kit
E-UNEL-M0018-01 5x 96 Tests

Uncoated Mouse CHEM (Chemerin) ELISA Kit

Sign In for Pricing
View Details