Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q1LTU8

Expression Region

1-273

Origin

Baumannia cicadellinicola subsp. Homalodisca coagulata

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKLVDNTTTRDYISHHLSHLQLNLNNFTLVNHPDIKSFWILNIDSIFFTLLLGIIFLLI FFYTAKTATSGIPSKLQTIVELLVSFIDKNVNDILFCKNKLIAPLALTIFIWIFLMNLMD LLAVDMLPYIAMYILHIPALRVVPSADINITLSLALGVFILIIYYNLKIKGITGFIKELT MQPFNHLIFIPLNFILESVSLLSKPISLALRLFGNIYAGELVFILIAGLLPWWSQWIISV PWALFHIIVITLQAFIFMVLTVVYIAMAYEQHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAX1 Protein Vector (Human) (pPB-C-His)
PV019221 500 ng

HAX1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Human Peptidylprolyl Isomerase F (PPIF) Antibody Pair Kit (with Standard)
MBS2100545-01 5x 96 Tests

Human Peptidylprolyl Isomerase F (PPIF) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Peptidylprolyl Isomerase F (PPIF) Antibody Pair Kit (with Standard)
MBS2100545-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Peptidylprolyl Isomerase F (PPIF) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Peptidylprolyl Isomerase F (PPIF) Antibody Pair Kit (with Standard)
MBS2100545-03 10x 96 Tests

Human Peptidylprolyl Isomerase F (PPIF) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Peptidylprolyl Isomerase F (PPIF) Antibody Pair Kit (with Standard)
MBS2100545-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Peptidylprolyl Isomerase F (PPIF) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Recombinant Influenza A virus Hemagglutinin (HA), partial
MBS7137006-01 0.02 mg (Mammalian-Cell)

Recombinant Influenza A virus Hemagglutinin (HA), partial

Sign In for Pricing
View Details