Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

P67389

Expression Region

1-273

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQREGESKGRLTLIHILLGMIPAVVLGLVFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSFLTAADIPMFAVGFVTAFVVALI AIKTFLQLIKRISFIPFAIYRFVVAAAVYVVFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPCR TGR7 (MRGPRD) Rabbit Polyclonal Antibody
TA368433 100 µL

GPCR TGR7 (MRGPRD) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
G protein alpha S (GNAS) (NM_001077489) Human Recombinant Protein
TP316883 20 µg

G protein alpha S (GNAS) (NM_001077489) Human Recombinant Protein

Sign In for Pricing
View Details
TRIOBP Rabbit Polyclonal Antibody
TA382842 100 µL

TRIOBP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ube2d3 Mouse Gene Knockout Kit (CRISPR)
KN518568 1 Kit

Ube2d3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MYL2 Polyclonal Antibody
E-AB-70328-01 60 µL

MYL2 Polyclonal Antibody

Sign In for Pricing
View Details
MYL2 Polyclonal Antibody
E-AB-70328-02 120 µL

MYL2 Polyclonal Antibody

Sign In for Pricing
View Details