Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

P67389

Expression Region

1-273

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQREGESKGRLTLIHILLGMIPAVVLGLVFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSFLTAADIPMFAVGFVTAFVVALI AIKTFLQLIKRISFIPFAIYRFVVAAAVYVVFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guvacoline Hydrochloride
TRC-G876510-25MG 25 mg

Guvacoline Hydrochloride

Sign In for Pricing
View Details
Human DPPA4 activation kit by CRISPRa
GA110609 1 Kit

Human DPPA4 activation kit by CRISPRa

Sign In for Pricing
View Details
Autoclave Bags
A9000C 200 Units/Case

Autoclave Bags

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike S1+S2 ECD (L18F, D80A, D215G, ΔLAL242-244, R246I, K417N, E484K, N501Y, D614G, A701V) (His Tag), Biotinylated
PKSV030359 20 µg

Recombinant SARS-CoV-2 Spike S1+S2 ECD (L18F, D80A, D215G, ΔLAL242-244, R246I, K417N, E484K, N501Y, D614G, A701V) (His Tag), Biotinylated

Sign In for Pricing
View Details
Human C12orf56 activation kit by CRISPRa
GA114543 1 Kit

Human C12orf56 activation kit by CRISPRa

Sign In for Pricing
View Details
FOXM1 Recombinant Rabbit monoclonal Antibody
HA751383 100 µL

FOXM1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details