Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalamin synthase (cobS)

This Recombinant Cobalamin synthase (cobS) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q6NG92

Expression Region

1-274

Origin

Corynebacterium diphtheriae

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGKAYFVNGEHGPAIIEGPLTALNWLTILPVPSATAFDRVTGGRVMASVPFIGIVLGIV GGAIAFAATSLGVASIVAATVIVCFWELFTRFMHLDGLADVSDALGSYAPPARAREIIAD PATGLIGMGACLISILIHISSFTALLDAHLWWMVMITPMIGRFCAIFGAHSRLKPMNPTG FGAMLIGTVKTHTIIAWLCVLLVICIGVPLAMDRGELITITILGLLCSVTLALVEIRHLH RRFEGMNGDTTGFIMHSATALCALVFAVGVGIVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B7-2, Recombinant, Human, Fc Fusion Protein (T-lymphocyte Activation Antigen CD86, B7.2, FUN-1, B70, BU63, CD86)
172313 100 µg

B7-2, Recombinant, Human, Fc Fusion Protein (T-lymphocyte Activation Antigen CD86, B7.2, FUN-1, B70, BU63, CD86)

Sign In for Pricing
View Details
H mgN2 Antibody
E38PA4674 100 µL

H mgN2 Antibody

Sign In for Pricing
View Details
UFM1 Protein Vector (Rat) (pPM-C-His)
PV314353 500 ng

UFM1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
PARD6G Protein Vector (Mouse) (pPB-C-His)
PV213534 500 ng

PARD6G Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
MycoLight™ vPCR350
24210-AAT 1 mg

MycoLight™ vPCR350

Sign In for Pricing
View Details
Rat Casp6 / Caspase-6 Recombinant Protein
R9634r 1 Each

Rat Casp6 / Caspase-6 Recombinant Protein

Sign In for Pricing
View Details