Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Nitrate transport permease protein nrtB (nrtB)

This Recombinant Synechocystis sp. Nitrate transport permease protein nrtB (nrtB) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Nitrate transport permease protein nrtB

UniProt

P73451

Expression Region

1-275

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASSTAGLRPRRKKNPLSFIYSPKVIRPAVAIAVLLVVWQILCSGEGSNLPSPVQVLEQT YPLILNPFFDNGGTDKGLGIQIFASLTRVAVGFSAAAVVGIALGILIGSSKFMYDALDPI FQVLRTIPPLAWLPIALAALQEAEPSAIFVIFITAIWPIVINTTVGAQQVPQDYRNVSRV LKLSKSQYFFNILFPAAVPYIFTGLRIGIGLSWLAIVAAEMLIGGVGIGFFIWDAYNSSL ISEIIIALIYVGIVGLLLDRFIAFLESLVVPAEQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF568 conjugate, 0.1mg/mL
BNC680322-500 1x 500 µL

CD3e (RIV9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
BNC470965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL
BNC940146-100 1x 100 µL

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF770 conjugate, 0.1mg/mL
BNC700160-100 1x 100 µL

CD20 (B9E9), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1712), CF647 conjugate, 0.1mg/mL
BNC471712-100 1x 100 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1712), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details