Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nocardioides sp. ATP synthase subunit a (atpB)

This Recombinant Nocardioides sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1SHI5

Expression Region

1-276

Origin

Nocardioides sp. (strain BAA-499 / JS614)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFAASVVRTAEGDGFTPPGPHDFDLPAIGGGHDTFEMFGQSFVLGVTKPMLQLVLAAIV LFVFFFAAARKRAMVPSRLQFVGEGFYGFVRNSLGRDIIGHDFAKFVPYLFTLFFFILLN NAFGSIPFIEFPTFSRSGMVYGLAVLSWVIYNAAGISKHGFVGYLKLQTVPGGIRGPILA LLIPLEFMSNILVRPVTLALRLFANMFAGHLLLILFALGGEYILTEMSVQYAPVGILAWL MFVAVAFLEMLIQFLQAYVFVLLNAMYISGAVADEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

q-32 qPCR Instrument
Z-genesig-q32 1 Each

q-32 qPCR Instrument

Sign In for Pricing
View Details
Parkin Antibody (N-term) Blocking peptide
MBS9226084-01 0.5 mg

Parkin Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details
Parkin Antibody (N-term) Blocking peptide
MBS9226084-02 5x 0.5 mg

Parkin Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details
TUBA1C Antibody
orb1333608 100 µg

TUBA1C Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal AFAP1L2 Antibody [DyLight 405]
NBP1-77358V 0.1 mL

Rabbit Polyclonal AFAP1L2 Antibody [DyLight 405]

Sign In for Pricing
View Details
TE Buffer, pH 7.6, RNase Free
42020326-3 500 mL

TE Buffer, pH 7.6, RNase Free

Sign In for Pricing
View Details