Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nocardioides sp. ATP synthase subunit a (atpB)

This Recombinant Nocardioides sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1SHI5

Expression Region

1-276

Origin

Nocardioides sp. (strain BAA-499 / JS614)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFAASVVRTAEGDGFTPPGPHDFDLPAIGGGHDTFEMFGQSFVLGVTKPMLQLVLAAIV LFVFFFAAARKRAMVPSRLQFVGEGFYGFVRNSLGRDIIGHDFAKFVPYLFTLFFFILLN NAFGSIPFIEFPTFSRSGMVYGLAVLSWVIYNAAGISKHGFVGYLKLQTVPGGIRGPILA LLIPLEFMSNILVRPVTLALRLFANMFAGHLLLILFALGGEYILTEMSVQYAPVGILAWL MFVAVAFLEMLIQFLQAYVFVLLNAMYISGAVADEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ASH2L Antibody [Alexa Fluor 488]
NB600-250AF488 0.1 mL

Rabbit Polyclonal ASH2L Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Recombinant Bovine Protein S100-A9 (S100A9), N-His-SUMO and C-Myc
AP9C265-01 1 mg

Recombinant Bovine Protein S100-A9 (S100A9), N-His-SUMO and C-Myc

Sign In for Pricing
View Details
Recombinant Bovine Protein S100-A9 (S100A9), N-His-SUMO and C-Myc
AP9C265-02 100 µg

Recombinant Bovine Protein S100-A9 (S100A9), N-His-SUMO and C-Myc

Sign In for Pricing
View Details
Recombinant Bovine Protein S100-A9 (S100A9), N-His-SUMO and C-Myc
AP9C265-03 20 µg

Recombinant Bovine Protein S100-A9 (S100A9), N-His-SUMO and C-Myc

Sign In for Pricing
View Details
TAF13 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
46071154 3x 1.0 µg DNA

TAF13 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
mmu-miR-875-3p miRNA Inhibitor
MIM03230 2x 5.0 nmol

mmu-miR-875-3p miRNA Inhibitor

Sign In for Pricing
View Details