Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ferrous iron permease EfeU (efeU)

This Recombinant Ferrous iron permease EfeU (efeU) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Ferrous iron permease EfeU, Fe (2+) ion permease EfeU, Ferrous iron uptake protein

UniProt

Q66BP6

Expression Region

1-285

Origin

Yersinia pseudotuberculosis

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSTFVPFLIMFREGLEAALIVSLIASYLKRTQRGQWMGAVWVGVVVAAVLCLAIGIFIN ETTGEFPQKQQELFEGIIAVVAVCILTYMVFWMRKVSKSVKVHLEGAIDNALNSGRGQGW ALVAMVFFAVAREGLESVFFLLAAFQQDVGIGAPIGAILGLVCAILVGMAIYWGGVKLHL AKFFKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQDIAFDLTDVLSTHSLLGTFLEGMF GYQEAPTVSEVSVYFIYLIPALILFFLPPRSTAGSAIAAARKINP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Raly 3'UTR Luciferase Stable Cell Line
TU217280 1.0 mL

Raly 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DYNC1I2 Rabbit pAb
E45R21275N-100 100 µL

DYNC1I2 Rabbit pAb

Sign In for Pricing
View Details
CYP71B13 Antibody
orb785274 2 mg

CYP71B13 Antibody

Sign In for Pricing
View Details
Rabbit Anti Human SYNPO Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC)
IRBAMLSYNPOAP61200UL 1 Each

Rabbit Anti Human SYNPO Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC)

Sign In for Pricing
View Details
Presenilin 1 Blocking Peptide
MBS822935-01 1 mg

Presenilin 1 Blocking Peptide

Sign In for Pricing
View Details
Presenilin 1 Blocking Peptide
MBS822935-02 5 mg

Presenilin 1 Blocking Peptide

Sign In for Pricing
View Details