Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ferrous iron permease EfeU (efeU)

This Recombinant Ferrous iron permease EfeU (efeU) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Ferrous iron permease EfeU, Fe (2+) ion permease EfeU, Ferrous iron uptake protein

UniProt

Q66BP6

Expression Region

1-285

Origin

Yersinia pseudotuberculosis

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSTFVPFLIMFREGLEAALIVSLIASYLKRTQRGQWMGAVWVGVVVAAVLCLAIGIFIN ETTGEFPQKQQELFEGIIAVVAVCILTYMVFWMRKVSKSVKVHLEGAIDNALNSGRGQGW ALVAMVFFAVAREGLESVFFLLAAFQQDVGIGAPIGAILGLVCAILVGMAIYWGGVKLHL AKFFKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQDIAFDLTDVLSTHSLLGTFLEGMF GYQEAPTVSEVSVYFIYLIPALILFFLPPRSTAGSAIAAARKINP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KANSL3 Rabbit pAb (APR28057N)
APR28057N-01 50 µL

KANSL3 Rabbit pAb (APR28057N)

Sign In for Pricing
View Details
KANSL3 Rabbit pAb (APR28057N)
APR28057N-02 100 µL

KANSL3 Rabbit pAb (APR28057N)

Sign In for Pricing
View Details
KANSL3 Rabbit pAb (APR28057N)
APR28057N-03 200 µL

KANSL3 Rabbit pAb (APR28057N)

Sign In for Pricing
View Details
HACD2 Polyclonal Antibody
A65662-020 20 µL

HACD2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse IL16 / Interleukin-16, Animal Free & Carrier Free
C-CYP204-20ug 20 µg

Recombinant Mouse IL16 / Interleukin-16, Animal Free & Carrier Free

Sign In for Pricing
View Details
GDF3 (Growth Differentiation Factor 3) (PE)
246535-PE 100 µL

GDF3 (Growth Differentiation Factor 3) (PE)

Sign In for Pricing
View Details