Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Synechococcus sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q3AH68

Expression Region

1-287

Origin

Synechococcus sp. (strain CC9605)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADPSASLNLVEACWRDLVLGVVQGLTEFLPISSTAHLKVVPELLGWGDPGVSVTAAIQL GSIAAVIAYFRTDLSQVLRGVSRAFRYGQWREPEARLGFAMVVGTLPILVIGLGIKFAWS QGYEQSPLRSIPSIAIVSIVMALLLALAEQVGARSKQLDVVLGRDGLLVGLAQALALLPG VSRSGSTLTAALFDGWQRADAARFSFLLGIPGITIAGLVELKDALAASPGNGPLPLLVGI GSAAVVSWLAIDWLLKFLQRNSTWLFVAYRLVFGLLLLVWWGVYGSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CDK8 ELISA Kit
orb564024-01 48 Tests

Human CDK8 ELISA Kit

Sign In for Pricing
View Details
Human CDK8 ELISA Kit
orb564024-02 96 Tests

Human CDK8 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Abca8a shRNA (UAS) - Lentiviral mouse Abca8a shRNA (UAS, RFP) (100)
GTR15287568 1 Vial

Lentiviral mouse Abca8a shRNA (UAS) - Lentiviral mouse Abca8a shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Plant Pollen allergen Phl p 6 (PHLPVI) Protein
abx060081 0.1 mg

Plant Pollen allergen Phl p 6 (PHLPVI) Protein

Sign In for Pricing
View Details
Rcn2 ORF Vector (Mouse) (pORF)
ORF055802 1.0 µg DNA

Rcn2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant MMP9 Antibody
RC-8571-01 50 μL

Recombinant MMP9 Antibody

Sign In for Pricing
View Details