Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Synechococcus sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q3AH68

Expression Region

1-287

Origin

Synechococcus sp. (strain CC9605)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADPSASLNLVEACWRDLVLGVVQGLTEFLPISSTAHLKVVPELLGWGDPGVSVTAAIQL GSIAAVIAYFRTDLSQVLRGVSRAFRYGQWREPEARLGFAMVVGTLPILVIGLGIKFAWS QGYEQSPLRSIPSIAIVSIVMALLLALAEQVGARSKQLDVVLGRDGLLVGLAQALALLPG VSRSGSTLTAALFDGWQRADAARFSFLLGIPGITIAGLVELKDALAASPGNGPLPLLVGI GSAAVVSWLAIDWLLKFLQRNSTWLFVAYRLVFGLLLLVWWGVYGSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRUPCR® NRAS Mutation Kit
3B1273 48 Reactions

TRUPCR® NRAS Mutation Kit

Sign In for Pricing
View Details
TEA domain family member 2 (TEAD2) (NM_003598) Human Tagged Lenti ORF Clone
RC203526L1 10 µg

TEA domain family member 2 (TEAD2) (NM_003598) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SARD4 Antibody
orb796046 2 mg

SARD4 Antibody

Sign In for Pricing
View Details
Plexin-A4 shRNA Plasmid (h)
sc-89871-SH 20 µg

Plexin-A4 shRNA Plasmid (h)

Sign In for Pricing
View Details
TREM2 Rabbit Polyclonal Antibody, 1 pack = 100 µL
BAL4124 1 Each

TREM2 Rabbit Polyclonal Antibody, 1 pack = 100 µL

Sign In for Pricing
View Details
Mouse Hnrnpd ELISA KIT
ELI-20339m 96 Tests

Mouse Hnrnpd ELISA KIT

Sign In for Pricing
View Details