Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Synechococcus sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q3AH68

Expression Region

1-287

Origin

Synechococcus sp. (strain CC9605)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADPSASLNLVEACWRDLVLGVVQGLTEFLPISSTAHLKVVPELLGWGDPGVSVTAAIQL GSIAAVIAYFRTDLSQVLRGVSRAFRYGQWREPEARLGFAMVVGTLPILVIGLGIKFAWS QGYEQSPLRSIPSIAIVSIVMALLLALAEQVGARSKQLDVVLGRDGLLVGLAQALALLPG VSRSGSTLTAALFDGWQRADAARFSFLLGIPGITIAGLVELKDALAASPGNGPLPLLVGI GSAAVVSWLAIDWLLKFLQRNSTWLFVAYRLVFGLLLLVWWGVYGSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMM50 Polyclonal Antibody
RD90055A-01 60 μL

TIMM50 Polyclonal Antibody

Sign In for Pricing
View Details
TIMM50 Polyclonal Antibody
RD90055A-02 120 μL

TIMM50 Polyclonal Antibody

Sign In for Pricing
View Details
TIMM50 Polyclonal Antibody
RD90055A-03 200 µL

TIMM50 Polyclonal Antibody

Sign In for Pricing
View Details
Plekha7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4706206 1.0 µg DNA

Plekha7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Anti-Mouse TCR α Antibody (H28-710), PerCP
MP957147-01 1 Each

Anti-Mouse TCR α Antibody (H28-710), PerCP

Sign In for Pricing
View Details
Anti-Mouse TCR α Antibody (H28-710), PerCP
MP957147-02 100 Tests

Anti-Mouse TCR α Antibody (H28-710), PerCP

Sign In for Pricing
View Details