Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Paracottus kneri Rhodopsin (rho)

This Recombinant Paracottus kneri Rhodopsin (rho) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

O42452

Expression Region

1-289

Origin

Paracottus kneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YLVSPAAYAALGAYMFLLILVGFPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFATLGGEIALWSLVVLAIERWIVVRKPISNFRFT EDHAIMGLGFSWVMASTCAVPPLVGWLRYIPEGMQCSCGVDYYTRAEGFNTESFVLYMFT VHFLIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRAEKEVSRMVVIMVIGYLVCWLPYA SVAWWIFCNQGSEFGPIFMTLPAFFAKTSAIYNPLIYICMNKQFRHCMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-500 1x 500 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
BNC881073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF640R conjugate, 0.1mg/mL
BNC400449-500 1x 500 µL

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
BNC881045-500 1x 500 µL

CD16 (C16/1045), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
BNC740017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details