Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aeromonas salmonicida Type 4 prepilin-like proteins leader peptide-processing enzyme (tapD)

This Recombinant Aeromonas salmonicida Type 4 prepilin-like proteins leader peptide-processing enzyme (tapD) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

A2T195

Expression Region

1-291

Origin

Aeromonas salmonicida (strain A449)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLLLELAHGLPWLYFSLVFLFSLMIGSFLNVVIHRLPIMLEREWQAEYRSYFSSDTPQP EDDERYNLMVPRSCCPRCNHPITALENIPLLSWLWLKGRCRGCQAAISARYPLVELLTAL LSVVVAMTLTPGWGTLAALLLTWVLVALTFIDLDKMLLPDQLTLPLLWGGLLFNLLGGYV PLGDAVIGAMAGYLVLWSLYWAFKLLTGKEGMGYGDFKLLAALGAWLGWQALPIVLLLSS LVGAIFGIGLILLRNHHQSKPIPFGPYLAIAGWIALLWGDSITRWYLSTIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SBDS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2091206 1.0 µg DNA

SBDS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
EPAS1, CT (EPAS1, BHLHE73, HIF2A, MOP2, PASD2, Endothelial PAS domain-containing protein 1, Basic-helix-loop-helix-PAS protein MOP2, Class E basic helix-loop-helix protein 73, HIF-1-alpha-like factor, Hypoxia-inducible factor 2-alpha, Member of PAS protein 2, PAS domain-containing protein 2)
035102 200 µL

EPAS1, CT (EPAS1, BHLHE73, HIF2A, MOP2, PASD2, Endothelial PAS domain-containing protein 1, Basic-helix-loop-helix-PAS protein MOP2, Class E basic helix-loop-helix protein 73, HIF-1-alpha-like factor, Hypoxia-inducible factor 2-alpha, Member of PAS protein 2, PAS domain-containing protein 2)

Sign In for Pricing
View Details
Human B7-H6 Protein, His Tag
orb545764-01 1 mg

Human B7-H6 Protein, His Tag

Sign In for Pricing
View Details
Human B7-H6 Protein, His Tag
orb545764-02 100 µg

Human B7-H6 Protein, His Tag

Sign In for Pricing
View Details
Sipa1l2 ORF Vector (Rat) (pORF)
ORF076255 1.0 µg DNA

Sipa1l2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Rat Carnitine Acetyltransferase (CRAT) ELISA Kit
MBS456438-01 48 Tests

Rat Carnitine Acetyltransferase (CRAT) ELISA Kit

Sign In for Pricing
View Details