Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (tapD)

This Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (tapD) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

P0C423

Expression Region

1-291

Origin

Aeromonas salmonicida

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLLLELAHGLPWLYFSLVFLFSLMIGSFLNVVIHRLPIMLEREWQAEYRSYFSSDTPQP EDDERYNLMVPRSCCPRCNHPITALENIPLLSWLWLKGRCRGCQAAISARYPLVELLTAL LSVVVAMTLTPGWGTLAALLLTWVLVALTFIDLDKMLLPDQLTLPLLWGGLLFNLLGGYV PLGDAVIGAMAGYLVLWSLYWAFKLLTGKEGMGYGDFKLLAALGAWLGWQALPIVLLLSS LVGAIFGIGLILLRNHHQSKPIPFGPYLAIAGWIALLWGDSITRWYLSTIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti-Mouse CD45-PE/CY5.5
1660-16 0.1 mg

Rat Anti-Mouse CD45-PE/CY5.5

Sign In for Pricing
View Details
NELF-B (h) -PR
sc-75896-PR 10 µM - 20 µL

NELF-B (h) -PR

Sign In for Pricing
View Details
Anhydrotetracycline Hydrochloride
259647-01 50 mg

Anhydrotetracycline Hydrochloride

Sign In for Pricing
View Details
Anhydrotetracycline Hydrochloride
259647-02 100 mg

Anhydrotetracycline Hydrochloride

Sign In for Pricing
View Details
Anhydrotetracycline Hydrochloride
259647-03 250 mg

Anhydrotetracycline Hydrochloride

Sign In for Pricing
View Details
Anhydrotetracycline Hydrochloride
259647-04 500 mg

Anhydrotetracycline Hydrochloride

Sign In for Pricing
View Details