Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (tapD)

This Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (tapD) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

P0C423

Expression Region

1-291

Origin

Aeromonas salmonicida

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLLLELAHGLPWLYFSLVFLFSLMIGSFLNVVIHRLPIMLEREWQAEYRSYFSSDTPQP EDDERYNLMVPRSCCPRCNHPITALENIPLLSWLWLKGRCRGCQAAISARYPLVELLTAL LSVVVAMTLTPGWGTLAALLLTWVLVALTFIDLDKMLLPDQLTLPLLWGGLLFNLLGGYV PLGDAVIGAMAGYLVLWSLYWAFKLLTGKEGMGYGDFKLLAALGAWLGWQALPIVLLLSS LVGAIFGIGLILLRNHHQSKPIPFGPYLAIAGWIALLWGDSITRWYLSTIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MINDY2 (NM_001040450) Human Over-expression Lysate
LC421766 20 µg

MINDY2 (NM_001040450) Human Over-expression Lysate

Sign In for Pricing
View Details
PIG-M siRNA (h)
sc-88676 10 µM

PIG-M siRNA (h)

Sign In for Pricing
View Details
CCDC30 Protein Vector (Mouse) (pPM-C-His)
PV162333 500 ng

CCDC30 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
rnf141 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7198003 1.0 µg DNA

rnf141 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Human Protein Tyrosine Phosphatase Non Receptor Type-4
MBS140697-01 0.005 mg

Recombinant Human Protein Tyrosine Phosphatase Non Receptor Type-4

Sign In for Pricing
View Details
Recombinant Human Protein Tyrosine Phosphatase Non Receptor Type-4
MBS140697-02 0.02 mg

Recombinant Human Protein Tyrosine Phosphatase Non Receptor Type-4

Sign In for Pricing
View Details