Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Adrenocorticotropic hormone receptor (MC2R)

This Recombinant Sheep Adrenocorticotropic hormone receptor (MC2R) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Adrenocorticotropic hormone receptor, ACTH receptor, ACTH-R, Adrenocorticotropin receptor, Melanocortin receptor 2, MC2-R

UniProt

Q9TU77

Expression Region

1-295

Origin

Ovis aries (Sheep)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRHILNLYENINSTARNNSDCPAVILPEEIFFTVSIVGVLENLMVLLAVAKNKSLQSPMY FFICSLAISDMLGSLYKILENVLIMFRNMGYLEPRGSFESTADDVVDSLFILSLLGSICS LSVIAADRYITIFHALQYHSIVTMHRALVVLTVLWAGCTGSGITIVTFSHHVPTVIAFTA LFPLMLAFILCLYVHMFLLARSHARRTSSLPKANMRGAITLTVLLGVFIFCWAPFVLHVL LMTFCPADPYCACYMSLFQVNGVLIMCNAVIDPFIYAFRSPELRVAFKKMVICNW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL
BNC040669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-100 1x 100 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL
BNC040630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF594 conjugate, 0.1mg/mL
BNC942406-500 1x 500 µL

Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF647 conjugate, 0.1mg/mL
BNC472066-500 1x 500 µL

CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details