Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Post-GPI attachment to proteins factor 3 (pgap3)

This Recombinant Xenopus tropicalis Post-GPI attachment to proteins factor 3 (pgap3) spans the amino acid sequence from region 19-316.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 3, PER1-like domain-containing protein 1

UniProt

Q0VFE3

Expression Region

19-316

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DREPVYRDCVTLCERNNCTGSRLTDFRAEQPLYMRVTGWTCLDDCRYQCMWYTVSLYLKE GHEVPQFHGKWPFSRFLFFQEPASALASFLNGVASLLMLLRYRSSVPSSCQMYRTCLAFS MVSVNAWFWSTIFHTRDTALTEKMDYFCASSVILHSIYLCCMRTFGLQYPSIANGFGAFL VLLFACHVSYLTLGRFDYSYNMAANTGFGVLNLMWWLAWCFRRRFHQPYLWKCVLVVISL QSLALLELLDFPPVMWILDAHALWHFSTVPLHFLFYSFLKDDSLYLLKINHDDIPKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-500 1x 500 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-100 1x 100 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
BNC041081-100 1x 100 µL

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
BNC401820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL
BNC400745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details