Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Free fatty acid receptor 1 (FFAR1)

This Recombinant Macaca fascicularis Free fatty acid receptor 1 (FFAR1) spans the amino acid sequence from region 1-300.

Product Specifications

Product Name Alternative

Free fatty acid receptor 1, G-protein coupled receptor 40

UniProt

Q76JV1

Expression Region

1-300

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLPPQLSFALYVAAFALGFPLNVLAIRGARAHARRRLTPSLVYALNLGCSDLLLTVSLP LKAVEALASGAWPLPASLCPVFGVAHFAPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP CYSWGVCAAIWALVLCHLGLVFVLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG PARFSLSLLLFFLPLAITAFCYVGCLRALAHSGLTHRRKLRAAWVAGGALLTLLLCVGPY NASNVASFLNPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGSTSQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-100 1x 100 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-100 1x 100 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (O10), CF647 conjugate, 0.1mg/mL
BNC470667-100 1x 100 µL

CD1a (O10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details