Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ignicoccus hospitalis Digeranylgeranylglyceryl phosphate synthase (Igni_0416)

This Recombinant Ignicoccus hospitalis Digeranylgeranylglyceryl phosphate synthase (Igni_0416) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

A8A9J7

Expression Region

1-303

Origin

Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEASGKLRAYLELVRAHNLLGTVLGVIAGAALLGEVNVAAAIASASAAAVAAGGYAINDY FDVEIDKVNKPERPIPSGRVGAEEARKLALALLALGPLLGLAVGPLTGAYAALNAVLMYY YSKSLKKTGLPGNLAVSFSTASTLLYGSLATAEWAGEVARVLRTIPIILMVFLMTLAREV VKGVEDYVGDKEGGVKTLAVVKGPDFALRAALALACASLALAYLAAPLLSLGYAFLAFVT LGGLLSLASVAACLRSEDPVRCAAKPRRAMKVAMFLGLIGILVDRLVQPVFYPHVLHAGG EEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFA3 (Defensin, alpha 3, Neutrophil-Specific, DEF3, HNP-3, HNP3, HP-3) (HRP)
MBS6183567-01 0.1 mL

DEFA3 (Defensin, alpha 3, Neutrophil-Specific, DEF3, HNP-3, HNP3, HP-3) (HRP)

Sign In for Pricing
View Details
DEFA3 (Defensin, alpha 3, Neutrophil-Specific, DEF3, HNP-3, HNP3, HP-3) (HRP)
MBS6183567-02 5x 0.1 mL

DEFA3 (Defensin, alpha 3, Neutrophil-Specific, DEF3, HNP-3, HNP3, HP-3) (HRP)

Sign In for Pricing
View Details
SPINK6 Rabbit Polyclonal Antibody (Biotin)
orb2104195 100 µL

SPINK6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
BDKRB2 polyclonal antibody
orb646831-01 50 μL

BDKRB2 polyclonal antibody

Sign In for Pricing
View Details
BDKRB2 polyclonal antibody
orb646831-02 100 µL

BDKRB2 polyclonal antibody

Sign In for Pricing
View Details
BDKRB2 polyclonal antibody
orb646831-03 200 µL

BDKRB2 polyclonal antibody

Sign In for Pricing
View Details