Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ignicoccus hospitalis Digeranylgeranylglyceryl phosphate synthase (Igni_0416)

This Recombinant Ignicoccus hospitalis Digeranylgeranylglyceryl phosphate synthase (Igni_0416) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

A8A9J7

Expression Region

1-303

Origin

Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEASGKLRAYLELVRAHNLLGTVLGVIAGAALLGEVNVAAAIASASAAAVAAGGYAINDY FDVEIDKVNKPERPIPSGRVGAEEARKLALALLALGPLLGLAVGPLTGAYAALNAVLMYY YSKSLKKTGLPGNLAVSFSTASTLLYGSLATAEWAGEVARVLRTIPIILMVFLMTLAREV VKGVEDYVGDKEGGVKTLAVVKGPDFALRAALALACASLALAYLAAPLLSLGYAFLAFVT LGGLLSLASVAACLRSEDPVRCAAKPRRAMKVAMFLGLIGILVDRLVQPVFYPHVLHAGG EEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pax-3/7 (B-5) Alexa Fluor® 488
sc-365843 AF488 200 µg/mL

Pax-3/7 (B-5) Alexa Fluor® 488

Sign In for Pricing
View Details
4-Bromo-3- (4-chlorophenyl) -5-methyl-1,2-oxazole
LAC23653-01 50 mg

4-Bromo-3- (4-chlorophenyl) -5-methyl-1,2-oxazole

Sign In for Pricing
View Details
4-Bromo-3- (4-chlorophenyl) -5-methyl-1,2-oxazole
LAC23653-02 0.5 g

4-Bromo-3- (4-chlorophenyl) -5-methyl-1,2-oxazole

Sign In for Pricing
View Details
RBMS2, NT (RBMS2, SCR3, RNA-binding motif, single-stranded-interacting protein 2, Suppressor of CDC2 with RNA-binding motif 3) (Biotin) discontinued
040904-Biotin 200 µL

RBMS2, NT (RBMS2, SCR3, RNA-binding motif, single-stranded-interacting protein 2, Suppressor of CDC2 with RNA-binding motif 3) (Biotin) discontinued

Sign In for Pricing
View Details
Human N-Terminal Propeptide Of Type I Collagen (PINP) ELISA Kit
MBS3800155-01 48 Well

Human N-Terminal Propeptide Of Type I Collagen (PINP) ELISA Kit

Sign In for Pricing
View Details
Human N-Terminal Propeptide Of Type I Collagen (PINP) ELISA Kit
MBS3800155-02 96 Well

Human N-Terminal Propeptide Of Type I Collagen (PINP) ELISA Kit

Sign In for Pricing
View Details