Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ignicoccus hospitalis Digeranylgeranylglyceryl phosphate synthase (Igni_0416)

This Recombinant Ignicoccus hospitalis Digeranylgeranylglyceryl phosphate synthase (Igni_0416) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

A8A9J7

Expression Region

1-303

Origin

Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEASGKLRAYLELVRAHNLLGTVLGVIAGAALLGEVNVAAAIASASAAAVAAGGYAINDY FDVEIDKVNKPERPIPSGRVGAEEARKLALALLALGPLLGLAVGPLTGAYAALNAVLMYY YSKSLKKTGLPGNLAVSFSTASTLLYGSLATAEWAGEVARVLRTIPIILMVFLMTLAREV VKGVEDYVGDKEGGVKTLAVVKGPDFALRAALALACASLALAYLAAPLLSLGYAFLAFVT LGGLLSLASVAACLRSEDPVRCAAKPRRAMKVAMFLGLIGILVDRLVQPVFYPHVLHAGG EEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MYZAP Knockout HEK293T cell line
GTR15409512 1 Vial

Human MYZAP Knockout HEK293T cell line

Sign In for Pricing
View Details
HSPB2 Rabbit Polyclonal Antibody (PE-Cy7)
orb879794 100 µL

HSPB2 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Rabbit Monoclonal Claudin-18.2 Antibody (CLDN18.2/8141R) [Janelia Fluor 525]
NBP3-24137JF525 0.1 mL

Rabbit Monoclonal Claudin-18.2 Antibody (CLDN18.2/8141R) [Janelia Fluor 525]

Sign In for Pricing
View Details
CLCA2 CRISPR Activation Plasmid (h)
sc-404824-ACT 20 µg

CLCA2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Rtf1 Mouse shRNA Plasmid (Locus ID 76246)
TL519572 1 Kit

Rtf1 Mouse shRNA Plasmid (Locus ID 76246)

Sign In for Pricing
View Details
ECEL1 Protein Vector (Mouse) (pPM-C-HA)
PV174312 500 ng

ECEL1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details