Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4X2 (OR4X2)

This Recombinant Human Olfactory receptor 4X2 (OR4X2) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Olfactory receptor 4X2, Olfactory receptor OR11-105

UniProt

Q8NGF9

Expression Region

1-303

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEFIFLVLSPNQEVQRVCFVIFLFLYTAIVLGNFLIVLTVMTSRSLGSPMYFFLSYLSF MEICYSSATAPKLISDLLAERKVISWWGCMAQLFFLHFFGGTEIFLLTVMAYDHYVAICK PLSYTTIMNWQVCTVLVGIAWVGGFMHSFAQILLIFHLLFCGPNVINHYFCDLVPLLKLA CSDTFLIGLLIVANGGTLSVISFGVLLASYMVILLHLRTWSSEGWCKALSTCGSHFAVVI LFFGPCVFNSLRPSTTLPIDKMVAVFYTVITAILNPVIYSLRNAEMRKAMKRLWIRTLRL NEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal FGFBP3 Antibody (002)
NBP2-89733-100ul 100 µL

Rabbit Monoclonal FGFBP3 Antibody (002)

Sign In for Pricing
View Details
Human PEDF/SerpinF1 ELISA Kit PicoKine®, Carrier-free
EK0896-carrier-free 96 Well With Removable Strips

Human PEDF/SerpinF1 ELISA Kit PicoKine®, Carrier-free

Sign In for Pricing
View Details
Rat eNOS (Endothelial NOS) ELISA Kit
ER21795 96 Tests

Rat eNOS (Endothelial NOS) ELISA Kit

Sign In for Pricing
View Details
5- (2,4,6-Trimethylphenyl) imidazolidine-2,4-dione
EDA17943-01 50 mg

5- (2,4,6-Trimethylphenyl) imidazolidine-2,4-dione

Sign In for Pricing
View Details
5- (2,4,6-Trimethylphenyl) imidazolidine-2,4-dione
EDA17943-02 0.5 g

5- (2,4,6-Trimethylphenyl) imidazolidine-2,4-dione

Sign In for Pricing
View Details
Kallikrein 8 (KLK8) Mouse Monoclonal Antibody [Clone:1H6]
E45M13679 100 µg

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody [Clone:1H6]

Sign In for Pricing
View Details