Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Taste receptor type 2 member 4 (Tas2r4)

This Recombinant Rat Taste receptor type 2 member 4 (Tas2r4) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 4, T2R4, T2R16, Taste receptor type 2 member 20, T2R20

UniProt

Q67ET0

Expression Region

1-304

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLWELYAFVFAASVVFNFVGIVANLFIIVIISKTWVKSHKISSSDKILFSLAITRFLTLG LFLLNTVYIATNTGRSVYFSTFFLLCWKFLDSNSLWLVTFLNCLYCVKITHFQHPVFLLL KRTVSMKTTSLLLACLLISAFTTLLYFVLTQISRFPEHIIGRNDTLFDVSDGILTLAASL ILSSLLQFLLNVTFASLLIHSLRRHVQKMQRNRSSFWNPQTEAHVGAMRLMICFLVLYIP YSIAALLYFPSYMRKNLRAQAACMIITAAYPPGHSILLIITHHKLKAKAKKICCFYKLRD FVSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5730528L13Rik Protein Lysate (Mouse) with C-HA Tag
10807034 100 µg

5730528L13Rik Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
ACAT2 mouse monoclonal antibody
MB4194 25 ul

ACAT2 mouse monoclonal antibody

Sign In for Pricing
View Details
1- (2,3-Dichlorophenyl) piperazine hydrochloride
PDK0039 1 g

1- (2,3-Dichlorophenyl) piperazine hydrochloride

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Necdin (NDN)
MBS2166005-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Necdin (NDN)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Necdin (NDN)
MBS2166005-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Necdin (NDN)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Necdin (NDN)
MBS2166005-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Necdin (NDN)

Sign In for Pricing
View Details